Proteintech, 18067-1-AP, KCNA1 Polyclonal antibody

Size: 20ul / 150ul The KCNA1 (18067-1-AP) by Proteintech is a Polyclonal antibody targeting KCNA1 in WB, ELISA applications with reactivity to human, mouse, rat samples 18067-1-AP targets KCNA1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Potassium voltage-gated channel subfamily A member 1 (KCNA1, also known as Kv1.1) is a voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney (PMID: 19903818; 8845167). KCNA1 expression was reduced in human cancers, and this decrease correlated with an increase in breast cancer aggressiveness (PMID: 23774215). Furthermore, Kv1.1 is expressed in the brain as a mature glycoprotein, which is reported to be 86 kDa (PMID: 16305740). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12699 Product name: Recombinant human KCNA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC101733 Sequence: MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESS Predict reactive species Full Name: potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) Calculated Molecular Weight: 495 aa, 56 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: BC101733 Gene Symbol: KCNA1 Gene ID (NCBI): 3736 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q09470 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.