Proteintech, 18071-1-AP, COX18 Polyclonal antibody

Size: 20ul / 150ul The COX18 (18071-1-AP) by Proteintech is a Polyclonal antibody targeting COX18 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 18071-1-AP targets COX18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, HeLa cells, NIH/3T3 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:300-1:600 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12709 Product name: Recombinant human COX18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-333 aa of BC101684 Sequence: ALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPDSTWILPISVGVINLLIVEICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVLYWLCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK Predict reactive species Full Name: COX18 cytochrome c oxidase assembly homolog (S. cerevisiae) Calculated Molecular Weight: 333 aa, 37 kDa Observed Molecular Weight: 37-40 kDa, 28-30 kDa GenBank Accession Number: BC101684 Gene Symbol: COX18 Gene ID (NCBI): 285521 RRID: AB_10638443 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N8Q8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.