Iright
BRAND / VENDOR: Proteintech

Proteintech, 18073-1-AP, FKBP9 Polyclonal antibody

CATALOG NUMBER: 18073-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FKBP9 (18073-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP9 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18073-1-AP targets FKBP9 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, L02 cells Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information FKBP9 (FK506-binding protein 9, also referred to as FKBP60 or FKBP63) belongs to a family of immunophilins that are able to bind to FK506, an immunosuppressive drug. Several members of the FKBP family, including FKBP9, FKBP13, FKBP23 and FKBP65, localize to the endoplasmic reticulum (ER) as they contain the ER retention motif H/R/KDEL (PMID:32111229). In addition, the FKBP9 mutation was also reported to be associated with disease-free survival rates in pheochromocytoma or paraganglioma (PMID:28386672). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12715 Product name: Recombinant human FKBP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 218-570 aa of BC101723 Sequence: KRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL Predict reactive species Full Name: FK506 binding protein 9, 63 kDa Calculated Molecular Weight: 570 aa, 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC101723 Gene Symbol: FKBP9 Gene ID (NCBI): 11328 RRID: AB_2878490 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95302 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924