Iright
BRAND / VENDOR: Proteintech

Proteintech, 18095-1-AP, PAPPA Polyclonal antibody

CATALOG NUMBER: 18095-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PAPPA (18095-1-AP) by Proteintech is a Polyclonal antibody targeting PAPPA in WB, IHC, ELISA applications with reactivity to human samples 18095-1-AP targets PAPPA in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Pregnancy-associated plasma protein A (PAPPA) is a metalloproteinase secreted by human placenta, and it can interact with IGF-binding proteins (IGFBPs) to regulate the proteolysis and the bioavailability of insulin-like growth factor (IGF). Circulating PAPPA represents a consolidated biomarker in combined first-trimester screening tests, allowing an early prenatal diagnosis of chromosomal abnormalities, preeclampsia, and intrauterine growth restriction risk. PAPPA is highly expressed in placenta and pregnancy serum (PMID: 34974815, 34974815). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11863 Product name: Recombinant human PAPPA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1279-1627 aa of BC078657 Sequence: ACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLQGYSHG Predict reactive species Full Name: pregnancy-associated plasma protein A, pappalysin 1 Calculated Molecular Weight: 1627 aa, 181 kDa Observed Molecular Weight: 180-220 kDa GenBank Accession Number: BC078657 Gene Symbol: PAPPA Gene ID (NCBI): 5069 RRID: AB_3085554 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13219 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924