Iright
BRAND / VENDOR: Proteintech

Proteintech, 18102-1-AP, SGCG Polyclonal antibody

CATALOG NUMBER: 18102-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SGCG (18102-1-AP) by Proteintech is a Polyclonal antibody targeting SGCG in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 18102-1-AP targets SGCG in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, human skeletal muscle tissue, human heart tissue, mouse skeletal muscle tissue, rat heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human heart tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12402 Product name: Recombinant human SGCG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-291 aa of BC074777 Sequence: MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL Predict reactive species Full Name: sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) Calculated Molecular Weight: 291 aa, 32 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC074777 Gene Symbol: SGCG Gene ID (NCBI): 6445 RRID: AB_2286186 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13326 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924