Proteintech, 18132-1-AP, OTOR Polyclonal antibody

Size: 20ul / 150ul The OTOR (18132-1-AP) by Proteintech is a Polyclonal antibody targeting OTOR in IHC, ELISA applications with reactivity to human samples 18132-1-AP targets OTOR in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12714 Product name: Recombinant human OTOR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-128 aa of BC101688 Sequence: LASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE Predict reactive species Full Name: otoraplin Calculated Molecular Weight: 128 aa, 14 kDa GenBank Accession Number: BC101688 Gene Symbol: OTOR Gene ID (NCBI): 56914 RRID: AB_2878505 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.