Proteintech, 18150-1-AP, Podocalyxin Polyclonal antibody

Size: 20ul / 150ul The Podocalyxin (18150-1-AP) by Proteintech is a Polyclonal antibody targeting Podocalyxin in WB, IHC, IF-P, ELISA applications with reactivity to human samples 18150-1-AP targets Podocalyxin in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human kidney tissue, HEK-293 cells, HepG2 cells Positive IHC detected in: human kidney tissue, human endometrial cancer tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:4000 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information Podocalyxin, also known as podocalyxin-like protein 1 (PODXL or PCLP1), is a transmembrane glycoprotein belonging to the CD34 family of sialomucins. Podocalyxin was originally identified as the major sialoprotein on podocytes of the kidney glomerulus but was later found to be expressed on vascular endothelial cells and early hematopoietic progenitors. It is involved in the regulation of both adhesion and cell morphology. In addition, podocalyxin is highly expressed in embryonic stem cells and aberrant expression of podocalyxin has been implicated in a wide range of cancers. Podocalyxin is a protein with a peptide bone of ∼55.5 kDa that undergoes a post‐translational glycosylation, the different molecular mass of podocalyxin indicates the extent and variability of glycosylation patterns (PMID: 17092254). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12844 Product name: Recombinant human TRA-1-60 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-428 aa of BC093730 Sequence: SPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSM Predict reactive species Full Name: podocalyxin-like Calculated Molecular Weight: 526 aa, 55 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC093730 Gene Symbol: Podocalyxin Gene ID (NCBI): 5420 RRID: AB_11044193 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00592 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.