Iright
BRAND / VENDOR: Proteintech

Proteintech, 18172-1-AP, RNASE2/EDN Polyclonal antibody

CATALOG NUMBER: 18172-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RNASE2/EDN (18172-1-AP) by Proteintech is a Polyclonal antibody targeting RNASE2/EDN in WB, IHC, ELISA applications with reactivity to human samples 18172-1-AP targets RNASE2/EDN in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human urine sample Positive IHC detected in: human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12834 Product name: Recombinant human RNASE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-161 aa of BC093678 Sequence: QFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII Predict reactive species Full Name: ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) Calculated Molecular Weight: 161 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC093678 Gene Symbol: RNASE2 Gene ID (NCBI): 6036 RRID: AB_3669293 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10153 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924