Iright
BRAND / VENDOR: Proteintech

Proteintech, 18173-1-AP, CLEC4G Polyclonal antibody

CATALOG NUMBER: 18173-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CLEC4G (18173-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC4G in IHC, IF-P, ELISA applications with reactivity to human samples 18173-1-AP targets CLEC4G in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CLEC4G, also known as LSECtin, is a member of the C-type lectin family of glycan-binding receptors that is expressed on sinusoidal endothelial cells in liver and lymph nodes. CLEC4G is a type II transmembrane protein of ∼40 kDa in size with a single C-type lectin-like domain at the COOH terminus, closest in homology to DC-SIGNR, DC-SIGN, and CD23. CLEC4G has been reported as a receptor for Japanese encephalitis virus (PubMed:24623090), ebolavirus (PubMed:16051304), SARS coronavirus/SARS-CoV (PubMed:16051304), lassa virus and Lymphocytic choriomeningitis virus glycoprotein (PubMed:22156524, PubMed:22673088). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12837 Product name: Recombinant human CLEC4G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-293 aa of BC093691 Sequence: GHDLLRTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQESALRELRERVTQGLAEAGRGREDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFSVPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKRHNC Predict reactive species Full Name: C-type lectin domain family 4, member G Calculated Molecular Weight: 293 aa, 33 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC093691 Gene Symbol: CLEC4G Gene ID (NCBI): 339390 RRID: AB_2878512 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXB4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924