Iright
BRAND / VENDOR: Proteintech

Proteintech, 18181-1-AP, NOP56 Polyclonal antibody

CATALOG NUMBER: 18181-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NOP56 (18181-1-AP) by Proteintech is a Polyclonal antibody targeting NOP56 in WB, IHC, ELISA applications with reactivity to human, mouse samples 18181-1-AP targets NOP56 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, A549 cells, HeLa cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Box C/D RNA-protein complexes (RNPs) guide the 2'-O-methylation of nucleotides in eukaryotic ribosomal RNAs. The box C/D and C'/D' RNP subcomplexes are each assembled with three sRNP core proteins. The Nop56 core protein mediates crucial protein-protein interactions required for both sRNP assembly and the methyltransferase reaction by bridging the L7Ae and fibrillarin core proteins [PMID:22496443]. NOP56 is a component of the box C/D small nucleolar ribonucleoprotein complexes that direct 2-prime-O-methylation of pre-ribosomal RNA (rRNA) during its maturation. It is predicted to function in an early to middle step in pre-rRNA processing [PMID:12777385]. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12882 Product name: Recombinant human NOP56 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 246-594 aa of BC104791 Sequence: DASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED Predict reactive species Full Name: NOP56 ribonucleoprotein homolog (yeast) Calculated Molecular Weight: 594 aa, 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC104791 Gene Symbol: NOP56 Gene ID (NCBI): 10528 RRID: AB_2152323 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00567 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924