Proteintech, 18187-1-AP, PAEP/Glycodelin Polyclonal antibody

Size: 20ul / 150ul The PAEP/Glycodelin (18187-1-AP) by Proteintech is a Polyclonal antibody targeting PAEP/Glycodelin in IHC, ELISA applications with reactivity to human samples 18187-1-AP targets PAEP/Glycodelin in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Glycodelin (also known as Progestagen Associated Endometrial Protein, PAEP, and Placental Protein 14, PP14) is a secreted human lipocalin-family protein mainly expressed in well-differentiated epithelial cells in human reproductive tissues, like endometrium and seminal vesicles. While different cells produce differentially glycosylated isoforms of Glycodelin: decidualized endometrium-derived glycodelin-A (GdA), seminal vesicle-derived glycodelin-S (GdS), glycodelin-F (isolated from follicular fluid), and glycodelin-C (isolated from cumulus cells). Glycodelin has been involved in cell differentiation and tumor growth. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12902 Product name: Recombinant human PAEP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 54-180 aa of BC069562 Sequence: KAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF Predict reactive species Full Name: progestagen-associated endometrial protein Calculated Molecular Weight: 180 aa, 21 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC069562 Gene Symbol: PAEP/Glycodelin Gene ID (NCBI): 5047 RRID: AB_2918059 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09466 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.