Proteintech, 18201-1-AP, Histone H1 Polyclonal antibody

Size: 20ul / 150ul The Histone H1 (18201-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 18201-1-AP targets Histone H1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, mouse kidney tissue, mouse lung tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Histone H1 is a key chromatin structural protein, which mediates higher-order chromatin folding. H1 is also emerging as an important epigenetic mark and regulator of gene expression and cellular differentiation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12704 Product name: Recombinant human Histone H1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC101593 Sequence: MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK Predict reactive species Full Name: histone cluster 1, H1a Calculated Molecular Weight: 215 aa, 22 kDa Observed Molecular Weight: 28 kDa, 30 kDa GenBank Accession Number: BC101593 Gene Symbol: Histone H1 Gene ID (NCBI): 3024 RRID: AB_10859820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02539 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.