Iright
BRAND / VENDOR: Proteintech

Proteintech, 18203-1-AP, PPM1L Polyclonal antibody

CATALOG NUMBER: 18203-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPM1L (18203-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18203-1-AP targets PPM1L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue Positive IHC detected in: human kidney tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information PPM1L(Protein phosphatase 1L) is also named as PP2CE.It belongs to the PP2C group of serine/threonine phosphatases, which are distinguished from other phosphatases by their structure, absolute requirement for Mg(2+) or Mn(2+), and insensitivity to okadaic acid. It has 4 isoforms produced by alternative splicing.This antibody is specific to PPM1L. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12775 Product name: Recombinant human PPM1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC104885 Sequence: MPAFSTTAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ Predict reactive species Full Name: protein phosphatase 1 (formerly 2C)-like Calculated Molecular Weight: 26 kDa, 41 kDa Observed Molecular Weight: 41-45 kDa GenBank Accession Number: BC104885 Gene Symbol: PPM1L Gene ID (NCBI): 151742 RRID: AB_10859821 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5SGD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924