Iright
BRAND / VENDOR: Proteintech

Proteintech, 18207-1-AP, CBLN1 Polyclonal antibody

CATALOG NUMBER: 18207-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CBLN1 (18207-1-AP) by Proteintech is a Polyclonal antibody targeting CBLN1 in WB, ELISA applications with reactivity to human, mouse, rat samples 18207-1-AP targets CBLN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, U-87 MG cells, Neuro-2a cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CBLN1 (Cerebellin-1) is also named as Precerebellin. CBLN1 is a newly identified synaptic organizer belonging to the C1q family. Cbln1 was recently identified as the missing ligand for the orphan glutamate receptor δ2 (GluD2) (PMID: 21342763). In the cerebellum, Cbln1 is produced and secreted from granule cells and works as a strong synapse organizer between Purkinje cells and parallel fibers, the axons of the granule cells (PMID: 24607546). The glycosylation modification of CBLN1 resulted in a larger molecular weight. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12835 Product name: Recombinant human CBLN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-193 aa of BC093692 Sequence: RGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL Predict reactive species Full Name: cerebellin 1 precursor Calculated Molecular Weight: 193 aa, 21 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC093692 Gene Symbol: CBLN1 Gene ID (NCBI): 869 RRID: AB_3669294 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23435 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924