Iright
BRAND / VENDOR: Proteintech

Proteintech, 18219-1-AP, UBE2S Polyclonal antibody

CATALOG NUMBER: 18219-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UBE2S (18219-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2S in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18219-1-AP targets UBE2S in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, COLO 320 cells, MCF-7 cells, MDA-MB-453s cells, mouse ovary tissue Positive IHC detected in: human skin cancer tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information UBE2S(Ubiquitin-conjugating enzyme E2 S) is also named as E2EPF and belongs to the ubiquitin-conjugating enzyme family. It acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C) and a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Overexpression of UBE2S can increase tumor cell proliferation, invasion, and metastasis through the VHL-HIF pathway (PMID:16819549). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12978 Product name: Recombinant human UBE2S protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC004236 Sequence: MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL Predict reactive species Full Name: ubiquitin-conjugating enzyme E2S Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC004236 Gene Symbol: UBE2S Gene ID (NCBI): 27338 RRID: AB_10598771 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16763 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924