Product Description
Size: 20ul / 150ul
The TM4SF5 (18239-1-AP) by Proteintech is a Polyclonal antibody targeting TM4SF5 in IHC, ELISA applications with reactivity to human, mouse, rat samples
18239-1-AP targets TM4SF5 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: human liver cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag13004 Product name: Recombinant human TM4SF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-160 aa of BC093688 Sequence: VRAGGKGCCGAGCCGNRCRMLRSVFSSAFGVLGAIYCLSVSGAGLRNGPRCLMNGEWGYHFEDTAGAYLLNRTLWDRCEAPPRVVPWNVTLFS Predict reactive species
Full Name: transmembrane 4 L six family member 5
Calculated Molecular Weight: 197 aa, 21 kDa
GenBank Accession Number: BC093688
Gene Symbol: TM4SF5
Gene ID (NCBI): 9032
RRID: AB_2878522
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O14894
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924