Iright
BRAND / VENDOR: Proteintech

Proteintech, 18258-1-AP, ATG13 Polyclonal antibody

CATALOG NUMBER: 18258-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATG13 (18258-1-AP) by Proteintech is a Polyclonal antibody targeting ATG13 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 18258-1-AP targets ATG13 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, BGC-823 cells, HeLa cells, human brain tissue, mouse cerebellum tissue, mouse testis tissue, mouse thymus tissue, Jurkat cells, HEK-293 cells, MCF-7 cells Positive IP detected in: SH-SY5Y cells Positive IHC detected in: mouse heart tissue, mouse brain tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ATG13 is one component protein of the ULK1 complex which is required for autophagosome formation and mitophagy. ATG13 has two nutrient regulatory phosphorylation sites and the phosphorylation status of ATG13 affect regulation of autophagy by modulating enzyme activity and cellular localization of ULK1. Besides, it has been reported the nonautophagic function of ATG13 on cardiac development for ATG13-deficient embryos show myocardial growth defects.(PMID:27387056, 26801615, 26644405) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13090 Product name: Recombinant human KIAA0652 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 131-481 aa of BC001331 Sequence: ITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ* Predict reactive species Full Name: KIAA0652 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57-63 kDa GenBank Accession Number: BC001331 Gene Symbol: ATG13 Gene ID (NCBI): 9776 RRID: AB_2130658 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75143 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924