Iright
BRAND / VENDOR: Proteintech

Proteintech, 18260-1-AP, LILRB3 Polyclonal antibody

CATALOG NUMBER: 18260-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LILRB3 (18260-1-AP) by Proteintech is a Polyclonal antibody targeting LILRB3 in WB, ELISA applications with reactivity to human samples 18260-1-AP targets LILRB3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood leukocyte Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The leukocyte immunoglobulin-like receptors (LIRs, also known as ILTs, CD85, and LILRs) comprise a family of related immunoregulatory receptors encoded within the leukocyte receptor cluster (LRC) at chromosomal region 19q13.4 (PMID: 11491530). LIRs are transmembrane proteins containing either two or four extracellular immunoglobulin domains, and have diverse functions, including the regulation of inflammation, immune tolerance, cell differentiation and nervous system plasticity (PMID: 16406677; 26040207). LILRB3, also known as ILT-5 or CD85a, belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). LILRB3 is found on the surface of a variety of cell types including monocytes/macrophages, granulocytes, NK cells and some T cells. It binds to MHC class I molecules and transduces a negative signal that inhibits stimulation of an immune response. LILRB3 has been reported as a myeloid cell checkpoint that elicits profound immunomodulation (PMID: 32870822). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13110 Product name: Recombinant human LILRB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-401 aa of BC112198 Sequence: RTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYRLDKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVNPSHRWRFTCYYYYMNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYS Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 Calculated Molecular Weight: 631 aa, 69 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC112198 Gene Symbol: LILRB3 Gene ID (NCBI): 11025 RRID: AB_2918060 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75022 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924