Proteintech, 18262-1-AP, PDK1 Polyclonal antibody

Size: 20ul / 150ul The PDK1 (18262-1-AP) by Proteintech is a Polyclonal antibody targeting PDK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 18262-1-AP targets PDK1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, HEK-293 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue Positive IP detected in: SiHa cells Positive IHC detected in: human liver cancer tissue, human heart tissue, human kidney tissue, human breast cancer tissue, mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information PDK1(pyruvate dehydrogenase kinase isoform 1) is also named as PDHK1 and belongs to the PDK/BCKDK protein kinase family. It inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism (PMID:17683942). Starvation increases islet PDK activity (PMID:11723055). PDK1 has 2 isoforms with the MW of 49 and 52 kD, and a 28aa-transit-peptide in the N-terminal can be removed in the mature form. This antibody is specific to PDK1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13121 Product name: Recombinant human PDK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-436 aa of BC039158 Sequence: MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA Predict reactive species Full Name: pyruvate dehydrogenase kinase, isozyme 1 Calculated Molecular Weight: 436 aa, 49 kDa Observed Molecular Weight: 46-55 kDa GenBank Accession Number: BC039158 Gene Symbol: PDK1 Gene ID (NCBI): 5163 RRID: AB_10598310 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15118 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.