Iright
BRAND / VENDOR: Proteintech

Proteintech, 18283-1-AP, CD93 Polyclonal antibody

CATALOG NUMBER: 18283-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD93 (18283-1-AP) by Proteintech is a Polyclonal antibody targeting CD93 in IHC, ELISA applications with reactivity to human samples 18283-1-AP targets CD93 in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CD93, also known as C1qR or C1qR(p), is a single-pass type I transmembrane glycoprotein and a member of the group 14 of the C-type lectin-like domain (CTLD) superfamily, which also includes endosialin/CD248, thrombomodulin, and CLEC14A (PMID: 31287944). CD93 consists of a C-type lectin-like domain, five EGF-like repeats, a mucin-like domain, a transmembrane domain and a cytoplasmic domain (PMID: 28912033). CD93 is mainly expressed on endothelial cells and has been reported to be expressed by neurons and various cells of the hematopoietic system, including monocytes, neutrophils, B cells, natural killer cells, platelets and hematopoietic stem cells (PMID: 37443812). CD93 plays a role in various physiological processes including angiogenesis, inflammation, and cell adhesion (PMID: 31287944). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13132 Product name: Recombinant human CD93 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-572 aa of BC028075 Sequence: WGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQN Predict reactive species Full Name: CD93 molecule Calculated Molecular Weight: 69 kDa GenBank Accession Number: BC028075 Gene Symbol: CD93 Gene ID (NCBI): 22918 RRID: AB_2878528 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPY3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924