Proteintech, 18334-1-AP, PIGS Polyclonal antibody

Size: 20ul / 150ul The PIGS (18334-1-AP) by Proteintech is a Polyclonal antibody targeting PIGS in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 18334-1-AP targets PIGS in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HepG2 cells, mouse liver tissue, PC-3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PIGS, also named as GPI transamidase component PIG-S or PRO4316, is a 555 amino acid protein, which belongs to the PIGS family. PIGS localizes in the endoplasmic reticulum membrane. PIGS is a component of the GPI transamidase complex. It is essential for transfer of GPI to proteins, particularly for formation of carbonyl intermediates. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12950 Product name: Recombinant human PIGS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 313-555 aa of BC001319 Sequence: SSAASLYPVLNFLLYVPELAHSPLYIQDKDGAPVATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEVDMVRVMEVFLAQLRLLFGIAQPQLPPKCLLSGPTSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLVKIFLETRKSWRKPEKTD Predict reactive species Full Name: phosphatidylinositol glycan anchor biosynthesis, class S Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC001319 Gene Symbol: PIGS Gene ID (NCBI): 94005 RRID: AB_2878532 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96S52 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.