Proteintech, 18340-1-AP, S100G/Calbindin-D9k Polyclonal antibody

Size: 20ul / 150ul The S100G/Calbindin-D9k (18340-1-AP) by Proteintech is a Polyclonal antibody targeting S100G/Calbindin-D9k in IHC, ELISA applications with reactivity to human, mouse samples 18340-1-AP targets S100G/Calbindin-D9k in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information S100G also named calbindin D9K, is a vitamin D-dependent calcium-binding protein. This cytosolic protein belongs to a family of calcium-binding proteins that includes calmodulin, parvalbumin, troponin C, and S100 protein. In the intestine, the protein is vitamin D-dependent and its expression correlates with calcium transport activity. The protein may increase Ca2+ absorption by buffering Ca2+ in the cytoplasm and increase ATP-dependent Ca2+ transport in duodenal basolateral membrane vesicles. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13109 Product name: Recombinant human S100G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC112174 Sequence: MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ Predict reactive species Full Name: S100 calcium binding protein G Calculated Molecular Weight: 79 aa, 9 kDa GenBank Accession Number: BC112174 Gene Symbol: S100G Gene ID (NCBI): 795 RRID: AB_3085561 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29377 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.