Proteintech, 18344-1-AP, IGLV6-57 Polyclonal antibody

Size: 20ul / 150ul The IGLV6-57 (18344-1-AP) by Proteintech is a Polyclonal antibody targeting IGLV6-57 in WB, ELISA applications with reactivity to human samples 18344-1-AP targets IGLV6-57 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13141 Product name: Recombinant human IGLV6-57 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-148 aa of BC023973 Sequence: MAWAPLLLTLLAHCTGSWANFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGRAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHTVLQTHGEVRQKLPRASLPGPVSACLHRRG Predict reactive species Full Name: immunoglobulin lambda variable 6-57 Calculated Molecular Weight: 148 aa, 16 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC023973 Gene Symbol: IGLV6-57 Gene ID (NCBI): 28778 RRID: AB_2878534 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.