Iright
BRAND / VENDOR: Proteintech

Proteintech, 18395-1-AP, SLN Polyclonal antibody

CATALOG NUMBER: 18395-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLN (18395-1-AP) by Proteintech is a Polyclonal antibody targeting SLN in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18395-1-AP targets SLN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information SLN, also named as Sarcolipin, belongs to the sarcolipin family. It is associated with calcium ATPase SERCA1. It inhibits SERCA pumps. SLN, a key regulator of cardiac sarco(endo)plasmic reticulum (SR) Ca(2+) ATPase, is predominantly expressed in atria and mediates β-adrenergic responses. SLN can self-assembly to dimer and oligomer for playing importantphysiological function. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat, squirrel Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13176 Product name: Recombinant human SLN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-31 aa of BC005261 Sequence: MGINTRELFLNFTIVLITVILMWLLVRSYQY Predict reactive species Full Name: sarcolipin Calculated Molecular Weight: 31 aa, 4 kDa GenBank Accession Number: BC005261 Gene Symbol: SLN Gene ID (NCBI): 6588 RRID: AB_2286622 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00631 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924