Iright
BRAND / VENDOR: Proteintech

Proteintech, 18475-1-AP, ID1 Polyclonal antibody

CATALOG NUMBER: 18475-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ID1 (18475-1-AP) by Proteintech is a Polyclonal antibody targeting ID1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 18475-1-AP targets ID1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information ID (inhibitor of DNA binding) proteins contain a helix-loop-helix (HLH) motif and regulate tissue-specific transcription within several cell lineages. They do not bind DNA directly, but inhibit lineage commitment by binding basic helix-loop-helix (bHLH) transcription factors through their HLH motif. ID1 proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID proteins contribute to cell growth, senescence, differentiation, and angiogenesis. Inhibitor of differentiation or DNA binding-1 (ID1) interacts with the transactivation domain of p65 (p65TAD) both in vitro and in vivo. The molecular weight of ID1 is about 20 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13359 Product name: Recombinant human ID1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC000613 Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR Predict reactive species Full Name: inhibitor of DNA binding 1, dominant negative helix-loop-helix protein Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC000613 Gene Symbol: ID1 Gene ID (NCBI): 3397 RRID: AB_2248812 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41134 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924