Proteintech, 18569-1-AP, SMMHC Polyclonal antibody

Size: 20ul / 150ul The SMMHC (18569-1-AP) by Proteintech is a Polyclonal antibody targeting SMMHC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18569-1-AP targets SMMHC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse bladder tissue, mouse uterus tissue, rat uterus tissue Positive IHC detected in: human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13391 Product name: Recombinant human MYH11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC101677 Sequence: MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVS Predict reactive species Full Name: myosin, heavy chain 11, smooth muscle Calculated Molecular Weight: 1938 aa, 224 kDa Observed Molecular Weight: 227 kDa GenBank Accession Number: BC101677 Gene Symbol: SMMHC/MYH11 Gene ID (NCBI): 4629 RRID: AB_10644123 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.