Proteintech, 18592-1-AP, FOXO1 Polyclonal antibody

Size: 20ul / 150ul The FOXO1 (18592-1-AP) by Proteintech is a Polyclonal antibody targeting FOXO1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 18592-1-AP targets FOXO1 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells, HEK-293T cells, HepG2 cells, SGC-7901 cells, mouse brain tissue, rat brain tissue, mouse kidney tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: Daudi cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information FOXO1, also named as FOXO1A, FKHR and FKH1, is a member of the FOXO subfamily of Forkhead transcription factors. FOXO1 is a transcription factor which acts as a regulator of cell responses to oxidative stress. FOXO1 interacts with LRPPRC and SIRT1. In the presence of KIRT1, FOXO1 mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence. FOXO1 contains three predicted protein kinase B phosphorylation sites (Thr-24, Ser-256, and Ser-319) that are conserved in other FOXO proteins. The t(2;13) and the variant t(1;13) translocations generate PAX3/FKHR and PAX7/FKHR fusion proteins respectively. The resulting protein is a transcriptional activator. Defects in FOXO1 are a cause of rhabdomyosarcoma type 2 (RMS2). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, bovine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13296 Product name: Recombinant human FOXO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-655 aa of BC021981 Sequence: SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG Predict reactive species Full Name: forkhead box O1 Calculated Molecular Weight: 655 aa, 70 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC021981 Gene Symbol: FOXO1 Gene ID (NCBI): 2308 RRID: AB_10860103 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12778 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.