Proteintech, 18659-1-AP, Islet 2 Polyclonal antibody

Size: 20ul / 150ul The Islet 2 (18659-1-AP) by Proteintech is a Polyclonal antibody targeting Islet 2 in WB, ELISA applications with reactivity to human, mouse, rat samples 18659-1-AP targets Islet 2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13333 Product name: Recombinant human ISL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-359 aa of BC012136 Sequence: MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET Predict reactive species Full Name: ISL LIM homeobox 2 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC012136 Gene Symbol: ISL2 Gene ID (NCBI): 64843 RRID: AB_2878556 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96A47 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.