Iright
BRAND / VENDOR: Proteintech

Proteintech, 18894-1-AP, HOXB9 Polyclonal antibody

CATALOG NUMBER: 18894-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HOXB9 (18894-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB9 in WB, ELISA applications with reactivity to human, mouse, rat samples 18894-1-AP targets HOXB9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HT-29 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information HOXB9 is a member of the Homeobox (HOX) gene family, which plays a crucial role in embryonic development and is involved in the regulation of gene expression during this process. In addition to its role in embryogenesis, HOXB9 has been implicated in various cancers, including breast and prostate cancer. It is overexpressed in breast cancer tissue and is regulated by estrogen, playing a critical role in angiogenesis. HOXB9 overexpression has been shown to stimulate three-dimensional colony formation in soft-agar assays, indicating its role in tumorigenesis. Furthermore, HOXB9 binds to the promoters of various tumor growth and angiogenic factors, regulating their expression, and its homeodomain plays a crucial role in transcriptional regulation and tumorigenesis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13502 Product name: Recombinant human HOXB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-202 aa of BC015565 Sequence: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEK Predict reactive species Full Name: homeobox B9 Calculated Molecular Weight: 250 aa, 28 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC015565 Gene Symbol: HOXB9 Gene ID (NCBI): 3219 RRID: AB_3085571 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17482 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924