Iright
BRAND / VENDOR: Proteintech

Proteintech, 18898-1-AP, NEURL Polyclonal antibody

CATALOG NUMBER: 18898-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NEURL (18898-1-AP) by Proteintech is a Polyclonal antibody targeting NEURL in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 18898-1-AP targets NEURL in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse brain tissue, Y79 cells, SH-SY5Y cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NEURL(Neuralized-like protein 1A) is also named as NEURL1, NEURL1A, RNF67.Neurl1 is a RING-dependent E3 ubiquitin ligase that can regulate Notch signaling in mammals and it expression promotes lysosomal degradation of Jagged1 in cells and blocks signaling from Jagged1-expressing cells to neighboring Notch-expressing cells. Neurl-dependent turnover of Jagged1 and inhibition of Notch signaling depends upon N-terminal myristoylation and plasma membrane localization of Neurl1(PMID:18077452).This antibody is specific to NEURL. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13531 Product name: Recombinant human NEURL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC026336 Sequence: MGNNFSSIPSLPRGNPSRAPRGHPQNLKDSIGGPFPVTSHRCHHKQKHCPAVLPSGGLPAAPLLFHPHTKGSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVDVYGLTRGVQLLDSELVLPDCLRPRSFTALRRPSLRREADDARLSVSLCDLNVPGADGDEAAPAASCPIPQNSLNSQHSRALPAQLDGDLRFHALRAGAHVRILDEQTVARVEHGRDERALVFTSRPVRVAETIFVKVTRS Predict reactive species Full Name: neuralized homolog (Drosophila) Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 60-62 kDa GenBank Accession Number: BC026336 Gene Symbol: NEURL Gene ID (NCBI): 9148 RRID: AB_10642557 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O76050 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924