Iright
BRAND / VENDOR: Proteintech

Proteintech, 18901-1-AP, TAF3 Polyclonal antibody

CATALOG NUMBER: 18901-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TAF3 (18901-1-AP) by Proteintech is a Polyclonal antibody targeting TAF3 in WB, ELISA applications with reactivity to human samples 18901-1-AP targets TAF3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, cells, SW480 cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information TAF3, also named as TAF140, is a 140 kDa subunit of Transcription initiation factor TFIID. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. TAF3 has some isoforms with 727aa (~80 kDa), 622aa and 929aa (105 kDa). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13536 Product name: Recombinant human TAF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 443-721 aa of BC024661 Sequence: TKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLGTPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKEK Predict reactive species Full Name: TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa Calculated Molecular Weight: 929 aa, 104 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC024661 Gene Symbol: TAF3 Gene ID (NCBI): 83860 RRID: AB_2878567 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VWG9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924