Iright
BRAND / VENDOR: Proteintech

Proteintech, 18939-1-AP, MIDN Polyclonal antibody

CATALOG NUMBER: 18939-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MIDN (18939-1-AP) by Proteintech is a Polyclonal antibody targeting MIDN in WB, ELISA applications with reactivity to human, rat samples 18939-1-AP targets MIDN in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: PC-12 cells, BxPC-3 cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Midbrain nucleolar protein (midnolin, MIDN) is abundantly expressed in embryonic midbrain and localizes in the nucleus and nucleolus. MIDN mRNA was strongly and abundantly expressed during early developmental stages, and that the expression was not limited to midbrain but also expressed in diverse adult mouse tissues, including heart, spleen, lung, liver, skeletal muscle, kidney and testis. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13492 Product name: Recombinant human MIDN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 127-468 aa of BC094778 Sequence: TQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAARGDPSIASPVSSPCRPVSSAARVPPVPTSPSPASPSPITAGSFRSHAASTTCPEQMDCSPTASSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSPSRKAGRSDSSSSGGGGSPSEASGLGLDFEDSVWKPEANPDIKSEFVVA Predict reactive species Full Name: midnolin Calculated Molecular Weight: 468 aa, 49 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC094778 Gene Symbol: MIDN Gene ID (NCBI): 90007 RRID: AB_2878569 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q504T8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924