Iright
BRAND / VENDOR: Proteintech

Proteintech, 18940-1-AP, NECAB3 Polyclonal antibody

CATALOG NUMBER: 18940-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NECAB3 (18940-1-AP) by Proteintech is a Polyclonal antibody targeting NECAB3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18940-1-AP targets NECAB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, rat brain tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information NECAB3, also named as APBA2BP, NIP1, SYTIP2 and XB51, is a potential substrate of Nek2. NECAB3 inhibits the interaction of APBA2 with beta-amyloid precursor protein (APP). NECAB3 has three isoforms with MW 40 kDa, 44 kDa and 22 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13493 Product name: Recombinant human NECAB3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-362 aa of BC047673 Sequence: MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN Predict reactive species Full Name: N-terminal EF-hand calcium binding protein 3 Calculated Molecular Weight: 362aa,41 kDa; 396aa,44 kDa Observed Molecular Weight: 40-44 kDa GenBank Accession Number: BC047673 Gene Symbol: NECAB3 Gene ID (NCBI): 63941 RRID: AB_10596622 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96P71 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924