Proteintech, 18941-1-AP, LSM7 Polyclonal antibody

Size: 20ul / 150ul The LSM7 (18941-1-AP) by Proteintech is a Polyclonal antibody targeting LSM7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 18941-1-AP targets LSM7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13498 Product name: Recombinant human LSM7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-103 aa of BC018621 Sequence: MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA Predict reactive species Full Name: LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC018621 Gene Symbol: LSM7 Gene ID (NCBI): 51690 RRID: AB_10596483 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UK45 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.