Proteintech, 18972-1-AP, PAOX Polyclonal antibody

Size: 20ul / 150ul The PAOX (18972-1-AP) by Proteintech is a Polyclonal antibody targeting PAOX in WB, IHC, ELISA applications with reactivity to human, mouse samples 18972-1-AP targets PAOX in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue, human stomach tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information PAOX, also known as PAO, belongs to the flavin monoamine oxidase family. PAOX is a FAD-dependent amine oxidase, which is constitutively expressed in nearly all tissues of the vertebrate organism. PAOX catalyzes the oxidation of N1-acetylspermine to spermidine and thus involved in the polyamine back-conversion. PAOX can also oxidize N1-acetylspermidine to putrescine. PAOX has 4 isoforms with the molecular weights of 7, 35, 52 and 56 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5777 Product name: Recombinant human PAOX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-364 aa of BC032778 Sequence: RLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHHVIVTVPLGFLREHLDTFFDPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDAAPELQDAWFRKL Predict reactive species Full Name: polyamine oxidase (exo-N4-amino) Calculated Molecular Weight: 511 aa, 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC032778 Gene Symbol: PAOX Gene ID (NCBI): 196743 RRID: AB_2159196 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6QHF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.