Proteintech, 18973-1-AP, RTP1 Polyclonal antibody

Size: 20ul / 150ul The RTP1 (18973-1-AP) by Proteintech is a Polyclonal antibody targeting RTP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 18973-1-AP targets RTP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6934 Product name: Recombinant human RTP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 3-227 aa of BC034744 Sequence: RPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTKSQDQ Predict reactive species Full Name: receptor (chemosensory) transporter protein 1 Calculated Molecular Weight: 263 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC034744 Gene Symbol: RTP1 Gene ID (NCBI): 132112 RRID: AB_10550546 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P59025 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.