Proteintech, 19013-1-AP, NOX2 Polyclonal antibody

Size: 20ul / 150ul The NOX2 (19013-1-AP) by Proteintech is a Polyclonal antibody targeting NOX2 in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 19013-1-AP targets NOX2 in WB, IHC, IF-P, IF-Fro, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: J774A.1 cells, human plasma, RAW 264.7 cells, mouse spleen tissue, rat spleen tissue Positive IHC detected in: mouse spleen tissue, human tonsillitis tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue, human tonsillitis tissue Positive IF-Fro detected in: mouse brain tissue Positive FC (Intra) detected in: RAW 264.7 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information NOX2, also named as CYBB, CGD, 91-phox, gp91-1, gp91-phox, p22 phagocyte B-cytochrome, cytochrome b-245 and beta polypeptide, is a critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. This full length protein has three glycosylation sites. CYBB is found in human cardiomyocytes as multiple bands:the signal between 55 and 65 kDa is probably the unglycosylated protein, because the predicted molecular weight of unglycosylated CYBB protein is approximately 58 kDa(PMID: 17587483) to 65 kDa in phagocytes and the bands around 80 kDa probably represent glycosylated CYBB, as has also been shown in human umbilical vein endothelial cells(PMID:12610097). In other reports, it also can be detected a band of 91 kDa(PMID:19965781). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5536 Product name: Recombinant human CYBB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 418-570 aa of BC032720 Sequence: SILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF Predict reactive species Full Name: cytochrome b-245, beta polypeptide Calculated Molecular Weight: 577 aa, 65 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC032720 Gene Symbol: NOX2 Gene ID (NCBI): 1536 RRID: AB_2833044 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04839 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.