Iright
BRAND / VENDOR: Proteintech

Proteintech, 19050-1-AP, SGMS1 Polyclonal antibody

CATALOG NUMBER: 19050-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SGMS1 (19050-1-AP) by Proteintech is a Polyclonal antibody targeting SGMS1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 19050-1-AP targets SGMS1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, human heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Sphingomyelin synthase (SMS), with two isoforms, SMS1 (SGMS1) and SMS2, is a key enzyme involved in the generation and development of SM. SMS can participate in inflammation, atherosclerosis, proliferation, apoptosis, differentiation and other functions(PMID:30535436). SMS1 is frequently downregulated in various solid cancers, more particularly in melanoma(PMID:31114500). SGMS1 has two isoforms. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5246 Product name: Recombinant human SGMS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-145 aa of BC042899 Sequence: MKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPMPELERSQYPMEWGKTFLAFLYALSC Predict reactive species Full Name: sphingomyelin synthase 1 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 25 kDa, 49 kDa GenBank Accession Number: BC042899 Gene Symbol: SGMS1 Gene ID (NCBI): 259230 RRID: AB_2188417 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86VZ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924