Proteintech, 19142-1-AP, GDF8/Myostatin Polyclonal antibody

Size: 20ul / 150ul The GDF8/Myostatin (19142-1-AP) by Proteintech is a Polyclonal antibody targeting GDF8/Myostatin in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 19142-1-AP targets GDF8/Myostatin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue, mouse liver tissue, PC-3 cells, mouse heart tissue Positive IHC detected in: human heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Myostatin, also known as GDF-8, is a member of the TGF-beta superfamily. Myostatin is expressed in the myotome and developing skeletal muscles. Myostatin negatively regulates skeletal muscle growth and development through the regulation of anabolic and catabolic pathways in skeletal muscles. Myostatin immunoreactive bands could be identified at ∼50, 32-35, and 16 kDa, which correspond to the precursor, glycosylated dimmer, and monomer, respectively (PMID: 17711997). GDF8 may have cross-reactions with GDF11. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, zebrafish, bovine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13605 Product name: Recombinant human MSTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-375 aa of BC074757 Sequence: LNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS Predict reactive species Full Name: myostatin Calculated Molecular Weight: 375 aa, 43 kDa Observed Molecular Weight: 50 and 35 kDa GenBank Accession Number: BC074757 Gene Symbol: MSTN Gene ID (NCBI): 2660 RRID: AB_10638615 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14793 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.