Proteintech, 19159-1-AP, RFC1 Polyclonal antibody

Size: 20ul / 150ul The RFC1 (19159-1-AP) by Proteintech is a Polyclonal antibody targeting RFC1 in WB, ELISA applications with reactivity to human samples 19159-1-AP targets RFC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Replication factor C subunit 1 (RFC1) is a pentameric DNA polymerase accessory protein involved in DNA replication and repair (PMID: 10051561). It was reported as a cause of cerebellar ataxia with neuropathy and vestibular areflexia syndrome (CANVAS) (PMID: 30926972). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13585 Product name: Recombinant human RFC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 888-1147 aa of BC051751 Sequence: YIHVKPVAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRKGKGKSSKK Predict reactive species Full Name: replication factor C (activator 1) 1, 145kDa Calculated Molecular Weight: 128 kDa Observed Molecular Weight: 128-150 kDa GenBank Accession Number: BC051751 Gene Symbol: RFC1 Gene ID (NCBI): 5981 RRID: AB_2878574 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35251 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.