Proteintech, 19160-1-AP, TLL1 Polyclonal antibody

Size: 20ul / 150ul The TLL1 (19160-1-AP) by Proteintech is a Polyclonal antibody targeting TLL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 19160-1-AP targets TLL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TLL1 (Tolloid Like 1) is a Protein Coding gene. This gene encodes an astacin-like, zinc-dependent, metalloprotease that belongs to the peptidase M12A family. Diseases associated with TLL1 include Atrial Septal Defect 6 and Atrial Septal Defect, Ostium Primum Type. Among its related pathways are Collagen chain trimerization and Extracellular matrix organization. An important paralog of this gene is TLL2. TLL1 has 2 isoforms with the molecular mass of 115 and 44 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13639 Product name: Recombinant human TLL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-350 aa of BC016922 Sequence: LWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFWGDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIRRIGFGLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACG Predict reactive species Full Name: tolloid-like 1 Calculated Molecular Weight: 115 kDa Observed Molecular Weight: 42-44 kDa GenBank Accession Number: BC016922 Gene Symbol: TLL1 Gene ID (NCBI): 7092 RRID: AB_3085574 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43897 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.