Iright
BRAND / VENDOR: Proteintech

Proteintech, 19321-1-AP, H1FX Polyclonal antibody

CATALOG NUMBER: 19321-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The H1FX (19321-1-AP) by Proteintech is a Polyclonal antibody targeting H1FX in WB, ELISA applications with reactivity to human samples 19321-1-AP targets H1FX in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information H1FX (Histone H1x) belongs to the histone H1/H5 family which plays a crucial role in the organization and regulation of chromatin structure. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5819 Product name: Recombinant human H1FX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC000426 Sequence: MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPK Predict reactive species Full Name: H1 histone family, member X Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC000426 Gene Symbol: H1FX Gene ID (NCBI): 8971 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92522 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924