Proteintech, 19423-1-AP, HMP19 Polyclonal antibody

Size: 20ul / 150ul The HMP19 (19423-1-AP) by Proteintech is a Polyclonal antibody targeting HMP19 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 19423-1-AP targets HMP19 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13751 Product name: Recombinant human HMP19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC002619 Sequence: MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH Predict reactive species Full Name: HMP19 protein Calculated Molecular Weight: 171 aa, 19 kDa GenBank Accession Number: BC002619 Gene Symbol: HMP19 Gene ID (NCBI): 51617 RRID: AB_10638444 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y328 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.