Proteintech, 19598-1-AP, TRAPPC1 Polyclonal antibody

Size: 20ul / 150ul The TRAPPC1 (19598-1-AP) by Proteintech is a Polyclonal antibody targeting TRAPPC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 19598-1-AP targets TRAPPC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TRAPPC1, also known as BET5 or MUM2, is a part of the multisubunit TRAPP (transport protein particle) complexes which are involved in the tethering process at different trafficking steps of vesicle transport (PMID: 16828797). TRAPPC1 may play a role in vesicular transport from the endoplasmic reticulum to Golgi (PMID: 10582700). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5608 Product name: Recombinant human TRAPPC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-145 aa of BC032717 Sequence: MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG Predict reactive species Full Name: trafficking protein particle complex 1 Calculated Molecular Weight: 145 aa, 17 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC032717 Gene Symbol: TRAPPC1 Gene ID (NCBI): 58485 RRID: AB_3085582 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5R8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.