Iright
BRAND / VENDOR: Proteintech

Proteintech, 19825-1-AP, TMEM176B Polyclonal antibody

CATALOG NUMBER: 19825-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM176B (19825-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM176B in WB, ELISA applications with reactivity to human samples 19825-1-AP targets TMEM176B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information TMEM176B (also known as LR8) is a transmembrane protein belongs to the MS4A family of proteins. It may play a role in the process of maturation of dendritic cells. TMEM176B was first discovered in human lung fibroblasts and is associated with human small cell lung carcinoma. Studies suggest that TMEM176B might be involved in cancer and might serve as targets for antiangiogenic therapy of cancer patients (PMID: 24602018, 22244448). There are two isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13918 Product name: Recombinant human TMEM176B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 149-209 aa of BC004358 Sequence: SFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRAL Predict reactive species Full Name: transmembrane protein 176B Calculated Molecular Weight: 270 aa, 29 kDa Observed Molecular Weight: 31 kDa, 23 kDa GenBank Accession Number: BC004358 Gene Symbol: TMEM176B Gene ID (NCBI): 28959 RRID: AB_10638313 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3YBM2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924