Proteintech, 19832-1-AP, FUNDC2 Polyclonal antibody

Size: 20ul / 150ul The FUNDC2 (19832-1-AP) by Proteintech is a Polyclonal antibody targeting FUNDC2 in WB, IHC, ELISA applications with reactivity to human samples 19832-1-AP targets FUNDC2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, HepG2 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FUNDC2, or FUN14 domain-containing protein 2, is a mitochondrial outer membrane protein that plays a significant role in various cellular processes, including the regulation of cell survival, apoptosis, and metabolism. It has been implicated in the progression of several types of cancer, particularly in triple-negative breast cancer (TNBC) and liver cancer. In the context of cancer, FUNDC2 has been shown to promote tumorigenesis. It is associated with poor prognosis in hepatocellular carcinoma (HCC) and is involved in mitochondrial fragmentation by inhibiting MFN1-mediated mitochondrial fusion, which can lead to changes in cellular metabolism and energy levels. FUNDC2 also plays a role in platelet function and survival. It binds directly to phosphatidylinositol-3,4,5-trisphosphate (PIP3), which is a key lipid second messenger in cell signaling, and this interaction is crucial for the recruitment of PIP3 to mitochondria. FUNDC2 deficiency has been shown to decrease platelet aggregation and impair hemostasis in mice, highlighting its importance in platelet function. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13800 Product name: Recombinant human FUNDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC000255 Sequence: METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLF Predict reactive species Full Name: FUN14 domain containing 2 Calculated Molecular Weight: 189 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC000255 Gene Symbol: FUNDC2 Gene ID (NCBI): 65991 RRID: AB_3085587 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWH2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.