Iright
BRAND / VENDOR: Proteintech

Proteintech, 19836-1-AP, TWEAKR/CD266 Polyclonal antibody

CATALOG NUMBER: 19836-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TWEAKR/CD266 (19836-1-AP) by Proteintech is a Polyclonal antibody targeting TWEAKR/CD266 in IHC, ELISA applications with reactivity to human, mouse, rat samples 19836-1-AP targets TWEAKR/CD266 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TweakR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TweakR expression by other growth factors and/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13823 Product name: Recombinant human TWEAKR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-91 aa of BC002718 Sequence: LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 12A Calculated Molecular Weight: 129 aa, 14 kDa GenBank Accession Number: BC002718 Gene Symbol: TWEAKR Gene ID (NCBI): 51330 RRID: AB_3669316 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP84 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924