Product Description
Size: 20ul / 150ul
The STAG2 (19837-1-AP) by Proteintech is a Polyclonal antibody targeting STAG2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples
19837-1-AP targets STAG2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Jurkat cells, HeLa cells, K-562 cells, MCF-7 cells, NIH/3T3 cells
Positive IP detected in: U-251 cells, MCF-7 cells
Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
STAG2, also named as SA2, is a component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex may play a role in spindle pole assembly during mitosis. Mutations in STAG2 appear to be a first step in the transformation of a normal cell into a cancer cell.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag13825 Product name: Recombinant human STAG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1047-1172 aa of BC001765 Sequence: SLLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVE Predict reactive species
Full Name: stromal antigen 2
Calculated Molecular Weight: 1231 aa, 141 kDa
Observed Molecular Weight: 130-141 kDa
GenBank Accession Number: BC001765
Gene Symbol: STAG2
Gene ID (NCBI): 10735
RRID: AB_10666847
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8N3U4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924