Proteintech, 19839-1-AP, ZNF26 Polyclonal antibody

Size: 20ul / 150ul The ZNF26 (19839-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF26 in WB, ELISA applications with reactivity to human samples 19839-1-AP targets ZNF26 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13837 Product name: Recombinant human ZNF26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 335-533 aa of BC008211 Sequence: MHTGEKPYQCSDCGKAFNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK Predict reactive species Full Name: zinc finger protein 26 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC008211 Gene Symbol: ZNF26 Gene ID (NCBI): 7574 RRID: AB_2923570 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17031 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.