Iright
BRAND / VENDOR: Proteintech

Proteintech, 19848-1-AP, C14orf166 Polyclonal antibody

CATALOG NUMBER: 19848-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C14orf166 (19848-1-AP) by Proteintech is a Polyclonal antibody targeting C14orf166 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 19848-1-AP targets C14orf166 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse pancreas tissue, mouse lung tissue, Jurkat cells Positive IP detected in: Jurkat cells Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Human CLE/C14orf166 protein is a positive modulator of cellular RNA polymerase. CLE is also shown to interact with the influenza virus polymerase complex and colocalizes with viral ribonucleoproteins, and is required for viral replication. Similarly, CLE is identified as a novel host interacting partners of the mature hepatitis C virus core protein. CLE levels were significantly higher in the serum of patients with PaCa compared with the control group was strongly expressed in tumor cells, suggesting that C14orf166 may be a potential biomarker of pancreatic adenocarcinoma. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13900 Product name: Recombinant human CLE; C14orf166 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC001722 Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR Predict reactive species Full Name: chromosome 14 open reading frame 166 Calculated Molecular Weight: 244 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC001722 Gene Symbol: C14orf166 Gene ID (NCBI): 51637 RRID: AB_10646485 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y224 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924